PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.D69WY
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family STAT
Protein Properties Length: 740aa    MW: 82911 Da    PI: 6.1605
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.D69WYgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT170.92.2e-532463791122
         STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkis............qLsskcdnrLfrik 86 
                  ldvvll+ +gqpv+k+ ev asLlyad+ ++ve++ d+eap+L+sydG+ef+s++rp+kll Grasfklkis            qLsskcdnrLf ik
  Aradu.D69WY 246 LDVVLLDVFGQPVDKENEVYASLLYADTRAPVENTIDEEAPILASYDGIEFPSYERPSKLLLGRASFKLKISqfgtitnyvsicQLSSKCDNRLFLIK 343
                  8*********************************************************************9944444444444459************ PP

         STAT  87 feipklkkypfleavskpirCisrsrntrsssltkk 122
                  f++pkl +ypf+ea+s+pirCisrsrntr s+l++k
  Aradu.D69WY 344 FCVPKLGNYPFFEALSRPIRCISRSRNTRLSTLVWK 379
                  *****************************9999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF498997.04E-854198IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA:3.30.505.107.0E-7641712IPR000980SH2 domain
SuperFamilySSF555501.23E-8643723IPR000980SH2 domain
PROSITE profilePS500019.455649740IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 740 aa     Download sequence    Send to blast
MPSLGYSNFE RTATSKKRAK TKKEEIMFTD AIGNAGYSLL KDLRAEIEVK DGIFSLCFWV  60
YLANSTTFPA TIIQQVCSDV SESAPFLVIN DHKRINLLPL LLLHEEAPDT GNINSLTEVA  120
YATVDFEFPL QNWVHIGCEV CPNHMKLQIN GEIVGEKPLS SNKEPSSNDL RKIVLANIGG  180
DGNISHGYVY NFQVFPSVSS IKDHHMKDPP LKLSIDESSA SEIEEESDGV WSIVGGKASC  240
RRNFSLDVVL LDVFGQPVDK ENEVYASLLY ADTRAPVENT IDEEAPILAS YDGIEFPSYE  300
RPSKLLLGRA SFKLKISQFG TITNYVSICQ LSSKCDNRLF LIKFCVPKLG NYPFFEALSR  360
PIRCISRSRN TRLSTLVWKR SPGLAKHNLM QSSGMDDASF EHQHPVCEAK SNPLTKRFRF  420
GHDKISVSVK ADTNVEQPDE ECNSHARTTN QVENGLTTGL YGTPANYEAY ETLSDSESIG  480
ERNSPSNNVA SRRYPISDMT VFKYCLAGLA ERSLMLKEIA SLASKKEISE LAHHVSLYSG  540
CSHHGNQILI AKKLVEDGTN LWKVMSPNNN HVPWESAVYE IEEQFMKIAS CSSRSLSHQD  600
LELLRVIAGC QEYLAQENFE KLWCWLYPVA YIISKERINP IWNSTSPKWI EGFITKEEAE  660
ASLQGPTGLQ EPGTFVLRFP TSRSWPHPDA GSLIVTYVGN DYKLHHRLLS VDRDNKRPLG  720
SVELCRIPFT TQLSSFEGCL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015958463.10.0PREDICTED: uncharacterized protein LOC107482472 isoform X2
TrEMBLA0A151R0T30.0A0A151R0T3_CAJCA; Uncharacterized protein
STRINGGLYMA15G27760.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67103036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.10.0SH2 domain protein B